RetrogeneDB ID: | retro_rnor_2926 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | X:63702514..63702769(-) | ||
| Located in intron of: | ENSRNOG00000042530 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Snrpf | ||
| Ensembl ID: | ENSRNOG00000005556 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein F [Source:RefSeq peptide;Acc:NP_001119563] |
| Percent Identity: | 86.21 % |
| Parental protein coverage: | 97.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | LPLNPKPFLNGL-TGKPVMVKLKWGMEYKGYLVSVDGYMNMQLA-NTEEYIDGALSGHLGEVLIRCNNVL |
| LPLNPKPFLN.L.TGKPVMVKLKWGMEYKGY.VSVDGYMNMQL...TEEYIDGALSG.LG.VLIRCNNVL | |
| Retrocopy | LPLNPKPFLNRLTTGKPVMVKLKWGMEYKGYVVSVDGYMNMQLT<KTEEYIDGALSGYLGDVLIRCNNVL |
| Parental | YIRGV-EEEEEDGEMRE |
| YIRGV.EE.E.D.EMRE | |
| Retrocopy | YIRGV>EEKE*DEEMRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 5 .90 RPM |
| SRP017611_kidney | 0 .00 RPM | 5 .86 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .43 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000016271 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019817 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
| Homo sapiens | ENSG00000139343 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001127 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000009302 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007176 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000020018 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005835 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000004847 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009036 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005556 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000000895 | 1 retrocopy |