RetrogeneDB ID: | retro_rnor_2193 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 5:3821583..3821787(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Eny2 | ||
| Ensembl ID: | ENSRNOG00000004681 | ||
| Aliases: | None | ||
| Description: | enhancer of yellow 2 transcription factor homolog [Source:RefSeq peptide;Acc:NP_001124052] |
| Percent Identity: | 74.65 % |
| Parental protein coverage: | 68.32 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | VVSKMNKDAQMRAAINQKLIETGERERLKE-LLRAKLIECGWKDQLKAHC-KEVIKEKGLEHVTVDDLVA |
| VVSK..KD.Q.RA.INQK.IETGERE.LK..LLRA.LIE.GWKDQLKAHC.KE..KE..LEHVTVDD.VA | |
| Retrocopy | VVSKVSKDMQIRAVINQKPIETGERECLKD<LLRAQLIEYGWKDQLKAHC>KEI-KEN*LEHVTVDDFVA |
| Parental | E |
| . | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 39 .61 RPM |
| SRP017611_kidney | 0 .00 RPM | 35 .87 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .34 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000003039 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000007387 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007377 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010882 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027585 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000005873 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000022338 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004681 | 1 retrocopy |
retro_rnor_2193 ,
|
| Sarcophilus harrisii | ENSSHAG00000001787 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005590 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001742 | 3 retrocopies |