RetrogeneDB ID: | retro_rnor_1099 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 15:31341124..31341451(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rfk | ||
| Ensembl ID: | ENSRNOG00000022273 | ||
| Aliases: | None | ||
| Description: | riboflavin kinase [Source:RefSeq peptide;Acc:NP_001014128] |
| Percent Identity: | 85.32 % |
| Parental protein coverage: | 69.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VVRGFGRGSKQLGIPTANFPEQVVDNLPADVSTGIYYGWASVGSGEVHKMVVSIGWNPYYKNVKKSMETH |
| .V.GFG.GSKQ.GIPTAN.PEQVVDNL.ADVSTGIYYGWASVGSGE.HKMVVSIGWNPYYKNVKKSMETH | |
| Retrocopy | LVHGFGHGSKQPGIPTANIPEQVVDNLTADVSTGIYYGWASVGSGEDHKMVVSIGWNPYYKNVKKSMETH |
| Parental | IIHTFKEDFYGEILNVAIVGYLRPEKNFD-SLESLISAI |
| .IHTFKEDFYG.IL.VAIVG.LRPEKN.D..LE.LIS.I | |
| Retrocopy | VIHTFKEDFYGGILSVAIVG*LRPEKNLDIVLEPLISVI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 16 .54 RPM |
| SRP017611_kidney | 0 .00 RPM | 69 .29 RPM |
| SRP017611_liver | 0 .00 RPM | 26 .02 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000031816 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000015769 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000010358 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000988 | 6 retrocopies | |
| Monodelphis domestica | ENSMODG00000001904 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000024712 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001622 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013120 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000019302 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000022273 | 5 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000015887 | 3 retrocopies |