RetrogeneDB ID: | retro_ptro_269 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:221730548..221730988(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL10A | ||
| Ensembl ID: | ENSPTRG00000018085 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L10a [Source:HGNC Symbol;Acc:10299] |
| Percent Identity: | 81.46 % |
| Parental protein coverage: | 69.12 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | SVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILG-PGLNKAG |
| SVCVL..QQHC.EAKAVDIPHMDIE.LKK.N.NKKLVKKLAKK.DA.LASESLIKQIP..L..PGL.KAG | |
| Retrocopy | SVCVLEKQQHCNEAKAVDIPHMDIEVLKKFNQNKKLVKKLAKK*DALLASESLIKQIPKVLA<PGLHKAG |
| Parental | KFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVR |
| .FPSLL.HNEN....VDEVKSTIKFQM.KVLCLAV.VGHV..TD..LVYNIHL.VNFLVSLLKKNWQNV. | |
| Retrocopy | TFPSLLIHNEN---EVDEVKSTIKFQMTKVLCLAVTVGHVNVTDNKLVYNIHLTVNFLVSLLKKNWQNV* |
| Parental | ALYIKSTMGKP |
| ALYIK.TMGKP | |
| Retrocopy | ALYIKRTMGKP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 141 .85 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 162 .07 RPM |
| SRP007412_heart | 0 .00 RPM | 92 .39 RPM |
| SRP007412_kidney | 0 .00 RPM | 279 .14 RPM |
| SRP007412_liver | 0 .00 RPM | 160 .59 RPM |
| SRP007412_testis | 0 .00 RPM | 43 .42 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_337 |
| Gorilla gorilla | retro_ggor_358 |
| Pongo abelii | retro_pabe_357 |
| Macaca mulatta | retro_mmul_583 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000001318 | 18 retrocopies | |
| Echinops telfairi | ENSETEG00000013325 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028140 | 10 retrocopies | |
| Macropus eugenii | ENSMEUG00000005760 | 6 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000080 | 10 retrocopies | |
| Monodelphis domestica | ENSMODG00000013766 | 2 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000014574 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000004065 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000018085 | 13 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002763 | 9 retrocopies | |
| Rattus norvegicus | ENSRNOG00000000505 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000002047 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000023366 | 3 retrocopies |