RetrogeneDB ID: | retro_ptro_2656 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 7:133246981..133247446(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB9 | ||
| Ensembl ID: | ENSPTRG00000020569 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa (NDUFB9), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001071799] |
| Percent Identity: | 79.49 % |
| Parental protein coverage: | 87.15 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEE |
| .AF.A...YLTHQQKVLRL.K..L.HLE..C..RDKYRYFACLMRAR.EEH.NEKDM.KAT.LLKEAEEE | |
| Retrocopy | VAFSAPAAYLTHQQKVLRL*KWVLCHLELCCIHRDKYRYFACLMRARSEEHTNEKDMMKATRLLKEAEEE |
| Parental | FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREKWKKLRRESWEREVKQL |
| FWY.QHPQPYIFPDSP.GTSY....CYKVPEWCLDDWHPSEKAMYPDYFAKR..WKKLRRESW.REVKQL | |
| Retrocopy | FWYHQHPQPYIFPDSPRGTSYVTHECYKVPEWCLDDWHPSEKAMYPDYFAKRKQWKKLRRESWKREVKQL |
| Parental | QEETPPGGPLTEALPP |
| QEETPP.G.....LPP | |
| Retrocopy | QEETPPAGKEGD-LPP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 128 .73 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 72 .45 RPM |
| SRP007412_heart | 0 .09 RPM | 132 .47 RPM |
| SRP007412_kidney | 0 .05 RPM | 140 .28 RPM |
| SRP007412_liver | 0 .03 RPM | 97 .45 RPM |
| SRP007412_testis | 0 .00 RPM | 67 .97 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3905 |
| Gorilla gorilla | retro_ggor_2632 |
| Pongo abelii | retro_pabe_3182 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000010022 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000015852 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000012818 | 1 retrocopy | |
| Equus caballus | ENSECAG00000018238 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004678 | 1 retrocopy | |
| Homo sapiens | ENSG00000147684 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015883 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017481 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003765 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015493 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000001831 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005484 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030772 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000018869 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020569 | 2 retrocopies |
retro_ptro_2656 , retro_ptro_2791,
|
| Pteropus vampyrus | ENSPVAG00000009153 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021955 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000006895 | 3 retrocopies |