RetrogeneDB ID: | retro_ptro_2554 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 7:97968858..97969125(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AP1S1 | ||
| Ensembl ID: | ENSPTRG00000019520 | ||
| Aliases: | None | ||
| Description: | Adaptor-related protein complex 1, sigma 1 subunit [Source:UniProtKB/TrEMBL;Acc:K7B188] |
| Percent Identity: | 52.13 % |
| Parental protein coverage: | 59.87 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | SLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLK |
| ....CCA...Q.NEL..LE.IH.Y.ELL.KYFGSVCELD..FNFE..YFILDE....G.......K.... | |
| Retrocopy | NVQICCATVNQGNELTALETIHHYMELL-KYFGSVCELDVVFNFEEVYFILDELFLEGKLGNLQEKAI-- |
| Parental | AIEQADLLQEEDESPRSVLEEMGL |
| ...QADL.QEE...P..V..E.GL | |
| Retrocopy | --AQADLPQEEA*TPHRVVQEIGL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 107 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 29 .79 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .43 RPM |
| SRP007412_kidney | 0 .00 RPM | 87 .61 RPM |
| SRP007412_liver | 0 .00 RPM | 45 .34 RPM |
| SRP007412_testis | 0 .00 RPM | 6 .43 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3765 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002673 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029169 | 1 retrocopy | |
| Homo sapiens | ENSG00000106367 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016245 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000005406 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000009898 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000015867 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006239 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012979 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000019520 | 3 retrocopies |
retro_ptro_1234, retro_ptro_24, retro_ptro_2554 ,
|