RetrogeneDB ID: | retro_ptro_2483 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 6:133088529..133088978(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL15 | ||
| Ensembl ID: | ENSPTRG00000014695 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L15 [Source:HGNC Symbol;Acc:10306] |
| Percent Identity: | 83.12 % |
| Parental protein coverage: | 75.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGG |
| .GAYKYIQELWRKK.SDVM.FLLRVRC..Y.QLSA.HRAP.PT.PDKARRLGYKAKQ.....RIRVRRGG | |
| Retrocopy | VGAYKYIQELWRKKLSDVMHFLLRVRCC*YHQLSAFHRAPHPTCPDKARRLGYKAKQDC---RIRVRRGG |
| Parental | RKRPVPKG-ATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFH |
| .KRPVPKG..TYGKPVHHGVNQL.FARSLQS..EERAGRH.GALR.LNSYW.GE.STYKFFEVILIDPFH | |
| Retrocopy | *KRPVPKG<VTYGKPVHHGVNQLNFARSLQSFVEERAGRHFGALRILNSYWAGEGSTYKFFEVILIDPFH |
| Parental | KAIRRNPDTQWITK |
| KAIRRNPDT..ITK | |
| Retrocopy | KAIRRNPDTRRITK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 384 .18 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 392 .25 RPM |
| SRP007412_heart | 0 .00 RPM | 133 .81 RPM |
| SRP007412_kidney | 0 .03 RPM | 397 .82 RPM |
| SRP007412_liver | 0 .00 RPM | 190 .71 RPM |
| SRP007412_testis | 0 .00 RPM | 185 .79 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3661 |
| Gorilla gorilla | retro_ggor_2473 |
| Pongo abelii | retro_pabe_3004 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003497 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000003810 | 23 retrocopies |
retro_cjac_1052, retro_cjac_1270, retro_cjac_1316, retro_cjac_1553, retro_cjac_1578, retro_cjac_1625, retro_cjac_1668, retro_cjac_1741, retro_cjac_2143, retro_cjac_2330, retro_cjac_2518, retro_cjac_2532, retro_cjac_2599, retro_cjac_2821, retro_cjac_2907, retro_cjac_3807, retro_cjac_4185, retro_cjac_506, retro_cjac_585, retro_cjac_712, retro_cjac_734, retro_cjac_783, retro_cjac_890,
|
| Equus caballus | ENSECAG00000010157 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000011995 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014065 | 18 retrocopies | |
| Pan troglodytes | ENSPTRG00000014695 | 14 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000001771 | 13 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007244 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000008573 | 2 retrocopies |