RetrogeneDB ID: | retro_ptro_1384 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 19:62359288..62359609(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DESI2 | ||
| Ensembl ID: | ENSPTRG00000002180 | ||
| Aliases: | None | ||
| Description: | desumoylating isopeptidase 2 [Source:HGNC Symbol;Acc:24264] |
| Percent Identity: | 91.59 % |
| Parental protein coverage: | 58.47 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | FSQYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFL |
| ...YWM.EYTSSIGIGVFHS.IEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKE.VVLGSTDFL | |
| Retrocopy | YDTYWMKEYTSSIGIGVFHSEIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEVVVLGSTDFL |
| Parental | EDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEI |
| EDDIEKIVEELGKEYKGN.YHLM.KNCNHFSSALSE. | |
| Retrocopy | EDDIEKIVEELGKEYKGNVYHLMYKNCNHFSSALSEV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .09 RPM | 0 .52 RPM |
| SRP007412_cerebellum | 0 .65 RPM | 2 .62 RPM |
| SRP007412_heart | 0 .44 RPM | 2 .59 RPM |
| SRP007412_kidney | 0 .16 RPM | 1 .46 RPM |
| SRP007412_liver | 0 .20 RPM | 0 .88 RPM |
| SRP007412_testis | 8 .01 RPM | 25 .71 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1493 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000016 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003484 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000009507 | 2 retrocopies | |
| Homo sapiens | ENSG00000121644 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009797 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000004019 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015368 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000000055 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000002180 | 1 retrocopy |
retro_ptro_1384 ,
|
| Sus scrofa | ENSSSCG00000010876 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0033551 | 1 retrocopy |