RetrogeneDB ID: | retro_eeur_470 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_316590:21460..21810(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DESI2 | ||
| Ensembl ID: | ENSEEUG00000009507 | ||
| Aliases: | None | ||
| Description: | desumoylating isopeptidase 2 [Source:HGNC Symbol;Acc:24264] |
| Percent Identity: | 81.97 % |
| Parental protein coverage: | 75.5 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 7 |
| Parental | GGHPYPF-SGISDISPGNASELGETFKF-EAVVLGSTDFLEDDIEKIVEELGKEYKGNAYH-LMHKNCNH |
| GGHPYPF.SGI..ISPGNASELGETFKF.EAVVLGS.DFLEDDIEKIVEELGKEYKGNAYH.LMHKNCNH | |
| Retrocopy | GGHPYPF<SGIFEISPGNASELGETFKFKEAVVLGSPDFLEDDIEKIVEELGKEYKGNAYH>LMHKNCNH |
| Parental | -FSSALSE-ILCGKEI-PRWINRL-AYFSSCIPFLQS-CLPKEWLTPAALQS |
| .FSSALSE.ILCGK.I.P.W.NRL.AYFSSCIPFL.S.C..K..LT.AAL.. | |
| Retrocopy | >FSSALSE>ILCGKDI>PSWENRL>AYFSSCIPFLPS>CSGKK*LTLAALEA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 1 .45 RPM |
| SRP017611_kidney | 0 .00 RPM | 2 .81 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .80 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000016 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003484 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000009507 | 2 retrocopies |
retro_eeur_394, retro_eeur_470 ,
|
| Homo sapiens | ENSG00000121644 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009797 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000004019 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015368 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000000055 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000002180 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000010876 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0033551 | 1 retrocopy |