RetrogeneDB ID: | retro_pabe_450 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 1:147619904..147620330(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000012967 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.34 % |
| Parental protein coverage: | 58.37 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | MEVKPPPGRPQPDSGRRRRRR-GEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKW-GTLTDCVVMR |
| MEVK..P..P.PDS...R.RR.G.E.HDPKEPE..RKLFIG..SFETTDDSLREH.EKW.GTLTDC.VMR | |
| Retrocopy | MEVKLMPSGPKPDSSCGRHRR<GAEDHDPKEPE*FRKLFIGVPSFETTDDSLREHLEKW<GTLTDCMVMR |
| Parental | DPQTKRSRGFGFVTYSCVEEVDAAMCARPHK-VDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDT |
| .PQ.KRSRGFGF.TYSCVEEVDAA.CA.PHK.V.GR..EPKR..SRE.S.KP.AHL.VKK.F.GGIKEDT | |
| Retrocopy | HPQRKRSRGFGFITYSCVEEVDAATCAQPHK<VGGRLLEPKRTLSREESIKPDAHLPVKKNFLGGIKEDT |
| Parental | EEYNLR |
| EEYNLR | |
| Retrocopy | EEYNLR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 43 .29 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 35 .51 RPM |
| SRP007412_heart | 0 .06 RPM | 19 .42 RPM |
| SRP007412_kidney | 0 .00 RPM | 49 .22 RPM |
| SRP007412_liver | 0 .00 RPM | 24 .02 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_386 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011920 | 4 retrocopies | |
| Ficedula albicollis | ENSFALG00000003215 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000009250 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019803 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000002743 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000012967 | 1 retrocopy |
retro_pabe_450 ,
|
| Pongo abelii | ENSPPYG00000016107 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025850 | 4 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000003011 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018255 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012949 | 2 retrocopies | |
| Xenopus tropicalis | ENSXETG00000001806 | 1 retrocopy | |
| Xiphophorus maculatus | ENSXMAG00000000439 | 1 retrocopy |