RetrogeneDB ID: | retro_pabe_2357 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:142382578..142382847(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000025906 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 50.55 % |
| Parental protein coverage: | 72.0 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPV-EFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKG |
| MKLLTHNLLSSH..GV...GFP..L.ATEV.I.P.....P..VA.M.P...W...L..A..L.L..V.K. | |
| Retrocopy | MKLLTHNLLSSHMCGVRPSGFPR*L*ATEVHINPT<SSHPDLVACMVPNMKWAVLLRVANILLLVEVFKR |
| Parental | PVEGYEENEEFLRTMHHLLLE |
| P..G.E....FLR.MH..L.E | |
| Retrocopy | PI*G*EHEGKFLRKMHNVLQE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 50 .04 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 25 .66 RPM |
| SRP007412_heart | 0 .00 RPM | 12 .22 RPM |
| SRP007412_kidney | 0 .00 RPM | 66 .29 RPM |
| SRP007412_liver | 0 .00 RPM | 39 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017965 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000008646 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018026 | 1 retrocopy | |
| Equus caballus | ENSECAG00000016960 | 1 retrocopy | |
| Homo sapiens | ENSG00000173113 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001334 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000019647 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004991 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000025906 | 5 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000017134 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000019857 | 1 retrocopy |