RetrogeneDB ID: | retro_mmus_526 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 10:10040922..10041234(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rps9 | ||
| Ensembl ID: | ENSMUSG00000006333 | ||
| Aliases: | Rps9, 3010033P07Rik, AL022771, AL022885 | ||
| Description: | ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:1924096] |
| Percent Identity: | 53.15 % |
| Parental protein coverage: | 79.41 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | TYVTPRRPFE-KSRLDQELKLIGEYG-LRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLR |
| TY....RP.E..SRL..ELKL....G...N..EV.R.KFT..K..KA..ELL.L.E......F..NAL.. | |
| Retrocopy | TYMNSWRPLE<ESRLN*ELKLMKNVG<ILNNCEVCRIKFTSTKTCKAVQELLILGEI--QSIFKDNALVW |
| Parental | RLVRIG-VLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGL |
| .L...G..LDEGKMKL.YILGLKI..FL...L.TQVFK.GL | |
| Retrocopy | QLLPLG<ALDEGKMKLNYILGLKIKGFL-M*LHTQVFKTGL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .05 RPM | 67 .85 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 67 .52 RPM |
| SRP007412_heart | 0 .00 RPM | 154 .03 RPM |
| SRP007412_kidney | 0 .00 RPM | 120 .71 RPM |
| SRP007412_liver | 0 .00 RPM | 120 .79 RPM |
| SRP007412_testis | 0 .00 RPM | 68 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Gorilla gorilla | ENSGGOG00000027839 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000010394 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000006333 | 2 retrocopies |
retro_mmus_3082, retro_mmus_526 ,
|
| Nomascus leucogenys | ENSNLEG00000006314 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011449 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011355 | 7 retrocopies | |
| Rattus norvegicus | ENSRNOG00000049813 | 3 retrocopies |