RetrogeneDB ID: | retro_mmus_3501 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:103529694..103530116(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ebag9 | ||
| Ensembl ID: | ENSMUSG00000022339 | ||
| Aliases: | Ebag9, AI835379, Rcas1 | ||
| Description: | estrogen receptor-binding fragment-associated gene 9 [Source:MGI Symbol;Acc:MGI:1859920] |
| Percent Identity: | 85.21 % |
| Parental protein coverage: | 66.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | IEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGVPDGSTGFSSRLAATQDMPFIHQ |
| IEGGNG.VATQQNSLEQLEPDYF...TPTI.KTQKIVIKKREPLNFGVPDGSTGFSSRLAA.QD.PFIHQ | |
| Retrocopy | IEGGNGIVATQQNSLEQLEPDYFEAITPTIQKTQKIVIKKREPLNFGVPDGSTGFSSRLAAAQDRPFIHQ |
| Parental | SSELGDLDTWQENSNAWEEEEDAAWQAEEVLRQQKIADREKR-AAEQQRKKMEKEAQRLMKKEQNKIGVK |
| SS.LGDLDTWQEN..AWEEEEDAAWQAEEVL.QQKI.D.EKR..AEQQRKK.EKEAQR..KKEQ.K..VK | |
| Retrocopy | SSKLGDLDTWQENTSAWEEEEDAAWQAEEVLKQQKISDGEKR<TAEQQRKKTEKEAQRPIKKEQSKVCVK |
| Parental | LS |
| LS | |
| Retrocopy | LS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 1 .03 RPM | 16 .54 RPM |
| SRP007412_cerebellum | 0 .83 RPM | 16 .54 RPM |
| SRP007412_heart | 0 .31 RPM | 16 .16 RPM |
| SRP007412_kidney | 0 .40 RPM | 27 .83 RPM |
| SRP007412_liver | 0 .33 RPM | 22 .37 RPM |
| SRP007412_testis | 0 .05 RPM | 37 .69 RPM |
| ENCODE library ID | Target | ChIP-Seq Peak coordinates |
|---|---|---|
| ENCFF001YIJ | POLR2A | X:103529048..103529665 |
| ENCFF001YKA | POLR2A | X:103529022..103529681 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006190 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007848 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000001059 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000010177 | 2 retrocopies | |
| Equus caballus | ENSECAG00000009719 | 2 retrocopies | |
| Felis catus | ENSFCAG00000025490 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014115 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000004795 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000022339 | 1 retrocopy |
retro_mmus_3501 ,
|
| Rattus norvegicus | ENSRNOG00000004220 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006024 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000015326 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001745 | 2 retrocopies |