RetrogeneDB ID: | retro_mmus_2061 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:91523575..91523896(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000081834 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BC056474 | ||
| Ensembl ID: | ENSMUSG00000059355 | ||
| Aliases: | None | ||
| Description: | cDNA sequence BC056474 [Source:MGI Symbol;Acc:MGI:3041257] |
| Percent Identity: | 90.0 % |
| Parental protein coverage: | 59.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LQFAMSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFI |
| LQFAMSTNNMSDPR.PNKVLRY.PP.SECN.ALDDP..DYMNLL.MIFSMCGL.LKLKWCAWVAVYCSF. | |
| Retrocopy | LQFAMSTNNMSDPRSPNKVLRYQPPSSECNRALDDPILDYMNLLSMIFSMCGLTLKLKWCAWVAVYCSF- |
| Parental | SFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW |
| ..ANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW | |
| Retrocopy | --ANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 8 .04 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 4 .52 RPM |
| SRP007412_heart | 0 .00 RPM | 7 .10 RPM |
| SRP007412_kidney | 0 .00 RPM | 6 .58 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .42 RPM |
| SRP007412_testis | 0 .09 RPM | 1 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000028908 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005285 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019481 | 1 retrocopy | |
| Felis catus | ENSFCAG00000000463 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014450 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000059355 | 2 retrocopies |
retro_mmus_1327, retro_mmus_2061 ,
|
| Pteropus vampyrus | ENSPVAG00000013403 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013721 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001250 | 1 retrocopy |