RetrogeneDB ID: | retro_mmus_1908 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:40287243..40287678(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000081577 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Tdgf1 | ||
| Ensembl ID: | ENSMUSG00000032494 | ||
| Aliases: | Tdgf1, CR1, cripto | ||
| Description: | teratocarcinoma-derived growth factor 1 [Source:MGI Symbol;Acc:MGI:98658] |
| Percent Identity: | 82.88 % |
| Parental protein coverage: | 85.38 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVR |
| RDL.IRDNSIWDQKEPAV..RSFQFVPS.GIQ.SK.LNKTCCLNGGTC.LGSFCACPPSF...NCE.DV. | |
| Retrocopy | RDLVIRDNSIWDQKEPAVHERSFQFVPSMGIQSSKLLNKTCCLNGGTCNLGSFCACPPSF*-HNCEQDVH |
| Parental | KEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQTPSVTTTFMLAGACL |
| KEHCGSI..GT.LPKKCSLCRCWHGQLHC.PQTFLPGCDGHVM.QD.KAS.TPCQTPSV...FML.GACL | |
| Retrocopy | KEHCGSIIRGT*LPKKCSLCRCWHGQLHCFPQTFLPGCDGHVMYQDVKASRTPCQTPSVPSPFMLTGACL |
| Parental | FLDMKV |
| F..MKV | |
| Retrocopy | FVEMKV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .30 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .43 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .03 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .02 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002174 | 3 retrocopies | |
| Felis catus | ENSFCAG00000014508 | 1 retrocopy | |
| Homo sapiens | ENSG00000241186 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000003453 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000009140 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000016492 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003088 | 6 retrocopies | |
| Mustela putorius furo | ENSMPUG00000015167 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032494 | 3 retrocopies |
retro_mmus_1429, retro_mmus_1544, retro_mmus_1908 ,
|
| Nomascus leucogenys | ENSNLEG00000006143 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000017039 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014854 | 7 retrocopies | |
| Tarsius syrichta | ENSTSYG00000013609 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000017299 | 1 retrocopy |