RetrogeneDB ID: | retro_mmul_1578 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 20:28899545..28899955(-) | ||
| Located in intron of: | ENSMMUG00000020274 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C20orf27 | ||
| Ensembl ID: | ENSMMUG00000022079 | ||
| Aliases: | None | ||
| Description: | chromosome 20 open reading frame 27 [Source:HGNC Symbol;Acc:15873] |
| Percent Identity: | 61.59 % |
| Parental protein coverage: | 77.59 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | VVMVTQESDSSFLVKVGFLKILHRYEITFTL-PPVHRLSKDVREAPVPS-LHLKLLSVVPVPEGYSVKCE |
| ..MVTQ.SDSSFLVKVG.LKIL.RYEITFTL.PP.............P..LH.KLLSVVPVPEGYSVKCE | |
| Retrocopy | MIMVTQDSDSSFLVKVGLLKILRRYEITFTLPPPSAQAEQGHPRGTCPQPLHVKLLSVVPVPEGYSVKCE |
| Parental | YSAHKEGVLKEEILLACEGGTGTCVRVTVQARVMDRHHGTPM-LLDGVKCVGAELEYDSEHSDWHGFD |
| Y.AH.EG.LK.E.L.A.EGG.G..VR..VQA.....HH..P..L.DGVK...A.LE.D..HS.W.GFD | |
| Retrocopy | YLAHREGILKAEMLPAREGGAGASVRMVVQAGARGGHHCVPT<LRDGVKGSRATLE*DLQHSHWNGFD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 5 .71 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 29 .59 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 5 .10 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .06 RPM |
| SRP007412_kidney | 0 .00 RPM | 2 .93 RPM |
| SRP007412_liver | 0 .16 RPM | 19 .79 RPM |
| SRP007412_testis | 1 .51 RPM | 56 .77 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000021194 | 1 retrocopy | |
| Homo sapiens | ENSG00000101220 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016987 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000022079 | 1 retrocopy |
retro_mmul_1578 ,
|
| Nomascus leucogenys | ENSNLEG00000007653 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010813 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013204 | 2 retrocopies |