RetrogeneDB ID: | retro_meug_1101 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold288683:1056..1239(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDK2AP1 | ||
| Ensembl ID: | ENSMEUG00000009438 | ||
| Aliases: | None | ||
| Description: | cyclin-dependent kinase 2 associated protein 1 [Source:HGNC Symbol;Acc:14002] |
| Percent Identity: | 72.31 % |
| Parental protein coverage: | 56.52 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSYKPNLNAHMPGASLNPAGSVHSPSASMAASTQYRQLINDYGPPSLGYTQGTGSSQVPQSKYAE |
| .SY.PNLN..MP......A.SVHSPS.S.A.ST.Y.QLIN.YGPPSLGYTQG.GSSQVPQSKYAE | |
| Retrocopy | ISYRPNLNTYMP----RQARSVHSPSESTAGSTPYQQLINGYGPPSLGYTQGSGSSQVPQSKYAE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |