RetrogeneDB ID: | retro_rnor_1718 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 20:7440469..7440678(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Cdk2ap1 | ||
| Ensembl ID: | ENSRNOG00000001070 | ||
| Aliases: | None | ||
| Description: | cyclin-dependent kinase 2-associated protein 1 [Source:RefSeq peptide;Acc:NP_001107223] |
| Percent Identity: | 74.65 % |
| Parental protein coverage: | 61.4 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTG-NSQVPQSKYAELLAIIE |
| S.KPNL.AH.PAAALNA..VHS.ST.MATSSQ.R.LLSD.GPPSLGYTQGT..NSQ.PQS..AELLA..E | |
| Retrocopy | SDKPNLLAHLPAAALNARNVHSLSTRMATSSQHRELLSDCGPPSLGYTQGTE<NSQGPQSEGAELLATGE |
| Parental | E |
| . | |
| Retrocopy | D |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 62 .05 RPM |
| SRP017611_kidney | 0 .00 RPM | 45 .57 RPM |
| SRP017611_liver | 0 .00 RPM | 19 .63 RPM |