RetrogeneDB ID: | retro_mdom_952 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:11351290..11351650(+) | ||
| Located in intron of: | ENSMODG00000019413 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX11 | ||
| Ensembl ID: | ENSMODG00000014855 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase assembly homolog 11 (yeast) [Source:HGNC Symbol;Acc:2261] |
| Percent Identity: | 62.4 % |
| Parental protein coverage: | 51.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | FNADVHASLHWNFRPQQTEIYVVPGETALAFYKAKNPTDKSVIGISTYNVVPFEAGQYFNKIQCFC-FEE |
| F.A.V.ASL..........IY.V..........AK.PTDK.V.GIST.NVVPFEAG..FN....F..FEE | |
| Retrocopy | FDAHVQASLSPGILDLNKPIYGVRAGSGI--FQAKTPTDKPVFGISTSNVVPFEAGRDFNTMGSFV<FEE |
| Parental | QRLNPQEEVDMPVFFFIDPEFAEDPKMAKVDVITLSYT-FFEAKEGHKLPVPGYN |
| QRLN..EEVDMPVFFF.DPEFAEDPKMAKVDV.TLSYT.F...K..H.LPVPGYN | |
| Retrocopy | QRLNAPEEVDMPVFFFTDPEFAEDPKMAKVDVVTLSYT>FLKQKD-HQLPVPGYN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000008482 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000014862 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001207 | 1 retrocopy | |
| Homo sapiens | ENSG00000166260 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005225 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000014855 | 1 retrocopy |
retro_mdom_952 ,
|
| Mus musculus | ENSMUSG00000020544 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000007990 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000004138 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000008259 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000009422 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000046318 | 1 retrocopy |