RetrogeneDB ID: | retro_ggor_2761 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 8:118529321..118529674(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GABARAPL2 | ||
| Ensembl ID: | ENSGGOG00000012299 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected: | 1 |
| Parental | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL |
| .K..FKE.HSLEHRC.ES.KI.AKYPD.V.VIVEKVSGSQ.V..D....L.P.D.TVAQ...IIRKRIQL | |
| Retrocopy | IK*IFKEEHSLEHRCTESTKI*AKYPDQVLVIVEKVSGSQVVNTDNQRKLGPVDATVAQLI*IIRKRIQL |
| Parental | PSEKAIFLFVDKTVPQSSLTMGQL-YEKEKDEDGFLYV-AYSGENTFGF |
| PSEK.IFLFV.KTVP.SSLTMGQL...KEKDED.FLYV.AYS..N..GF | |
| Retrocopy | PSEKEIFLFVNKTVP*SSLTMGQL<FQKEKDED*FLYVLAYSTWNILGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 105 .69 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 89 .67 RPM |
| SRP007412_heart | 0 .00 RPM | 26 .95 RPM |
| SRP007412_kidney | 0 .00 RPM | 76 .99 RPM |
| SRP007412_liver | 0 .00 RPM | 37 .19 RPM |
| SRP007412_testis | 0 .00 RPM | 60 .30 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies | |
| Homo sapiens | ENSG00000034713 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies |
retro_ggor_2761 , retro_ggor_342,
|
| Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022360 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007565 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |