RetrogeneDB ID: | retro_ggor_2488 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 6:150282236..150282451(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000197416 | ||
| Ensembl ID: | ENSGGOG00000016835 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.9 % |
| Parental protein coverage: | 51.43 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | EEFEEITSGGHKTKSKVTLDKESLIQVQDWDGKETT-ITRKLVDGKMVVESTVNSVICTRTYEKVSSNSV |
| E..EE.T.GGHK.KS..TLD..SLIQVQDWD.KET..I.RKLV..KM.VES.V....C.........NSV | |
| Retrocopy | EKCEETTPGGHKIKSTITLDNDSLIQVQDWDHKETS<IGRKLVGEKMGVESAVSNITCAQI*GRE*TNSV |
| Parental | SNS |
| SNS | |
| Retrocopy | SNS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 28 .80 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014554 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000433 | 1 retrocopy | |
| Equus caballus | ENSECAG00000023552 | 1 retrocopy | |
| Homo sapiens | ENSG00000197416 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005964 | 8 retrocopies | |
| Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy |
retro_ggor_2488 ,
|
| Gorilla gorilla | ENSGGOG00000025475 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000008511 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000005319 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019337 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002515 | 1 retrocopy | |
| Oryzias latipes | ENSORLG00000008282 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022654 | 1 retrocopy |