RetrogeneDB ID: | retro_cjac_2486 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 4:150066869..150067168(-) | ||
| Located in intron of: | ENSCJAG00000019580 | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000032986 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP12 | ||
| Ensembl ID: | ENSCJAG00000000433 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 12 [Source:HGNC Symbol;Acc:34524] |
| Percent Identity: | 54.46 % |
| Parental protein coverage: | 71.43 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | VTISTDGDVITIKTKSIFKNNEISFKLGEEFEEVTPAGHKTKNKVTLDNESLIQVQDWDGKETTI-TRKL |
| ..IS..GDVI..K.KSIFKNNEI.FK...EFEE.TP.GHK.K....LDN.SLIQV.DWD.K.T....RKL | |
| Retrocopy | LSISRNGDVISTKMKSIFKNNEIAFKPRKEFEETTPGGHKIKSIPPLDNDSLIQVRDWDHKDTPM<GRKL |
| Parental | VDGKMVVESTVNNVICTRTYEKVSSNSVSNS |
| V..K..V...VNN.......E....NS.S.S | |
| Retrocopy | VVEKVGVANAVNNITYAQI*ERE*TNSASIS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 0 .00 RPM |
| SRP051959_heart | 0 .00 RPM | 0 .00 RPM |
| SRP051959_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP051959_liver | 0 .00 RPM | 0 .00 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .07 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .00 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .00 RPM |
| SRP051959_spleen | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014554 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000433 | 1 retrocopy |
retro_cjac_2486 ,
|
| Callithrix jacchus | ENSCJAG00000000444 | 4 retrocopies | |
| Equus caballus | ENSECAG00000023552 | 1 retrocopy | |
| Homo sapiens | ENSG00000197416 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000008511 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000005319 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019337 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002515 | 1 retrocopy | |
| Oryzias latipes | ENSORLG00000008282 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022654 | 1 retrocopy |