RetrogeneDB ID: | retro_ggor_1781 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 2b:61359542..61359776(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CBY1 | ||
| Ensembl ID: | ENSGGOG00000013226 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.79 % |
| Parental protein coverage: | 61.11 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | QSLKFENGQWIAETGVSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDEL |
| QS.KFENG.WIAET..SGGVDRRE.Q.L.R.N.QLEEEN.LL.LKVDILLDM.SE.TA.S.LMEKELD.. | |
| Retrocopy | QSQKFENGWWIAETAISGGVDRREAQCLHRQN*QLEEENSLLQLKVDILLDMFSETTAKSLLMEKELDAW |
| Parental | R-ISRKRK |
| ...S..RK | |
| Retrocopy | KSVSQRRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 19 .52 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 17 .39 RPM |
| SRP007412_kidney | 0 .00 RPM | 25 .19 RPM |
| SRP007412_liver | 0 .00 RPM | 13 .24 RPM |
| SRP007412_testis | 0 .00 RPM | 22 .07 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2344 |
| Pan troglodytes | retro_ptro_1716 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000001384 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000010982 | 1 retrocopy | |
| Homo sapiens | ENSG00000100211 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013226 | 1 retrocopy |
retro_ggor_1781 ,
|
| Myotis lucifugus | ENSMLUG00000003757 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000013150 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015153 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028533 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014373 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000001484 | 1 retrocopy |