RetrogeneDB ID: | retro_fcat_1794 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | F2:398320..398570(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPP1R11 | ||
| Ensembl ID: | ENSFCAG00000013592 | ||
| Aliases: | None | ||
| Description: | protein phosphatase 1, regulatory (inhibitor) subunit 11 [Source:HGNC Symbol;Acc:9285] |
Retrocopy-Parental alignment summary:
>retro_fcat_1794
GGGGCCCGGCTGAGTGAGACCTTCACTGAGAGAACTGAGCCAGAGAGACAGAGAGAGGACAGGAGCCTAACCATCAAACT
TCAGAAACAGAAGCCAGAGAAGATGGTAGAATGGACAAGTGACACTTGGACAACAAGCACATGGGGCGCCACCCATCAAA
GGCTGCTGTCATTCATGAGAAACCTAGGCATTTGGTGTGAGCTCCATGGAGAGTGATGAGGAAGAGAAGGACTGTGGTCT
TGCTGTGTGC
ORF - retro_fcat_1794 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 68.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
Retrocopy - Parental Gene Alignment:
| Parental | GAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDT-VDNEHMGRRSSKCCCIYEKPR-AFGE |
| GA.LSET.TE.T.......E.RSLTIKL.K.KPEK.VEWTSDT..DN.HMGR..SK...I.EKPR.AFG. | |
| Retrocopy | GARLSETFTERTEP-ERQREDRSLTIKLQKQKPEKMVEWTSDT<LDNKHMGRHPSKAAVIHEKPR<AFGV |
| Parental | SSTESDEEEEEGCGHTHC |
| SS.ESDEEE...CG...C | |
| Retrocopy | SSMESDEEEKD-CGLAVC |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 12 .17 RPM |
| SRP017611_kidney | 0 .00 RPM | 10 .82 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .26 RPM |
Felis catus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_fcat_1794 retrocopy.
Felis catus was not studied using FANTOM5 data.
retro_fcat_1794 was not experimentally validated.
Retrocopy orthology:
Felis catus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 12 parental genes, and 13 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020710 | 1 retrocopy | |
| Felis catus | ENSFCAG00000013592 | 1 retrocopy |
retro_fcat_1794 ,
|
| Gorilla gorilla | ENSGGOG00000026830 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006493 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012122 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016021 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000004933 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001598 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000029642 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017915 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008330 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003632 | 1 retrocopy |