RetrogeneDB ID: | retro_cjac_2880 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 7:55445319..55445695(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPP1R11 | ||
| Ensembl ID: | ENSCJAG00000020710 | ||
| Aliases: | None | ||
| Description: | protein phosphatase 1, regulatory (inhibitor) subunit 11 [Source:HGNC Symbol;Acc:9285] |
| Percent Identity: | 59.69 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMG-RRSSKC-C-CIYEKP |
| MA..GAGLS............EPEN.SL.IKLRK.KPEKKV.W.SDTVDNEHMG.R.SS.C.C.C..E.. | |
| Retrocopy | MADTGAGLS*XXXXXXXXXXXEPEN*SLSIKLRKQKPEKKVKWISDTVDNEHMG<RHSSECCC<CL*EHK |
| Parental | RAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRASLG--PTTPPQPPDPSQPPPGPMQH |
| .AFGESS.E...........TH.V.GHRKG...A.LG..PTTPPQPPDPSQPP.GP..H | |
| Retrocopy | LAFGESSMERMRRKKRAV-LTHYVHGHRKGLCHATLGPTPTTPPQPPDPSQPPSGPTKH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 17 .46 RPM |
| SRP051959_heart | 0 .00 RPM | 10 .58 RPM |
| SRP051959_kidney | 0 .00 RPM | 19 .30 RPM |
| SRP051959_liver | 0 .00 RPM | 14 .84 RPM |
| SRP051959_lung | 0 .00 RPM | 20 .24 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 21 .03 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 10 .35 RPM |
| SRP051959_spleen | 0 .00 RPM | 18 .30 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020710 | 1 retrocopy |
retro_cjac_2880 ,
|
| Felis catus | ENSFCAG00000013592 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026830 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006493 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012122 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016021 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000004933 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001598 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008330 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003632 | 1 retrocopy |