RetrogeneDB ID: | retro_etel_1371 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_255792:5429..5771(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NFU1 | ||
| Ensembl ID: | ENSETEG00000019002 | ||
| Aliases: | None | ||
| Description: | NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:16287] |
| Percent Identity: | 55.93 % |
| Parental protein coverage: | 72.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | DTPNPNSLKFIPGRPVL-ETRTMDFPTPA-SAFRSPLARQLFRIEGVKSVFLGPDFITVTKQSEE-LDWN |
| ..PNPN....IPG..VL.ETR..D..TPA.SA..S.LAR...R..GV..VF.G.DFI.V....E..L..N | |
| Retrocopy | NAPNPNRMMPIPGQAVL<ETRHTDASTPA<SARHSLLARTFLRTAGVETVFFGLDFIPVANERED<LSCN |
| Parental | LLKPDIYAAVMDFFASGLPPVTEETAS-EAGSEEDDEVVAMIKELLDT |
| .LKP...AA.MDF..SG...VTEETAS..AGSE.D.EV...IKELLDT | |
| Retrocopy | SLKPEMHAASMDFVPSGWLLVTEETASGGAGSETDEEVLETIKELLDT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005978 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019156 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019002 | 1 retrocopy |
retro_etel_1371 ,
|
| Homo sapiens | ENSG00000169599 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000435 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011805 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000006663 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000029993 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010101 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000016760 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000012339 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012016 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008616 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013765 | 1 retrocopy |