RetrogeneDB ID: | retro_ecab_576 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 21:27407468..27407855(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PRDX4 | ||
| Ensembl ID: | ENSECAG00000010085 | ||
| Aliases: | None | ||
| Description: | peroxiredoxin 4 [Source:HGNC Symbol;Acc:17169] |
| Percent Identity: | 58.09 % |
| Parental protein coverage: | 55.51 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 5 |
| Parental | LDFTFVCPTEIIAFG-DRIE-EFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQIS |
| LDFTF..PT..I..G.DRIE..FR.INTEV.AC.VDSQF..LAW...P..Q..L.P..I.LLSDLT..IS | |
| Retrocopy | LDFTFWGPTKTINLG<DRIE<DFRLINTEVRACPVDSQFAYLAWSGAPHTQRRLKPLEISLLSDLTR*IS |
| Parental | KDYGVYLEDSGHTLRGLFIIDDKG-ILRQITLNDLPVGR-SVDETLRLVQAFQYTD-KHGEVCPAG |
| K......E..GH.LRG.F..D.KG.I.RQ......PVGR.S.DE.LRLVQ.FQ.TD..HG.VCP.G | |
| Retrocopy | KNSSAG-ENLGHKLRGRFTTDEKG>IQRQFAMDNPPVGR<STDEVLRLVQVFQHTD<QHGNVCPGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 65 .35 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 11 .94 RPM |
| SRP021940_embryo | 0 .03 RPM | 26 .29 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 28 .87 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 32 .45 RPM |
| SRP021940_testis | 0 .00 RPM | 65 .48 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3165 |
| Gorilla gorilla | retro_ggor_1351 |
| Macaca mulatta | retro_mmul_2001 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006165 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000004185 | 1 retrocopy | |
| Equus caballus | ENSECAG00000008678 | 1 retrocopy | |
| Equus caballus | ENSECAG00000010085 | 1 retrocopy |
retro_ecab_576 ,
|
| Equus caballus | ENSECAG00000017026 | 1 retrocopy | |
| Homo sapiens | ENSG00000123131 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026790 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004904 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021366 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000004454 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000602 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012368 | 1 retrocopy |