RetrogeneDB ID: | retro_ecab_509 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 2:172359..172797(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS2 | ||
| Ensembl ID: | ENSECAG00000009065 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S2 [Source:HGNC Symbol;Acc:10404] |
| Percent Identity: | 56.95 % |
| Parental protein coverage: | 50.51 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | RGRGRGRGRGRGARGGKAEDKEWIPVTKLGRLVK-DMKIKSLEEIYLFSLPIK-ESEIIDFFLGASLKDE |
| .G.G.GR.....A..GKA.DK.W...TKLG..V..DMKIKSL.E.YLFS.P.K.ESE.....L...LKD. | |
| Retrocopy | KGHGLGRA*HQRAL*GKAKDKRWLLITKLGLMVR<DMKIKSLQEVYLFS-PSK<ESEVTNLVLETALKDK |
| Parental | VLKIMPVQKQTRAGQRTRFK-AFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKI |
| V.KI.P.QKQT..GQ.T.FK.AFV.I.DY.GHVGLG.KCS.EVA.A...A..L...SI....RG....K. | |
| Retrocopy | VWKIRPLQKQTCTGQQTKFK<AFVTIRDYSGHVGLGGKCSREVAVATHWATVLVHNSIDAGWRGHKWIKF |
| Parental | GKPHTVPCKVT |
| GKPHT.PCKVT | |
| Retrocopy | GKPHTIPCKVT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 1345 .23 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 357 .55 RPM |
| SRP021940_embryo | 0 .05 RPM | 851 .49 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 688 .28 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 1087 .71 RPM |
| SRP021940_testis | 0 .00 RPM | 354 .05 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000002549 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019472 | 19 retrocopies |
retro_cfam_1028, retro_cfam_1252, retro_cfam_1321, retro_cfam_1460, retro_cfam_1560, retro_cfam_1592, retro_cfam_1842, retro_cfam_1848, retro_cfam_1932, retro_cfam_1983, retro_cfam_2007, retro_cfam_2012, retro_cfam_2046, retro_cfam_2053, retro_cfam_2110, retro_cfam_271, retro_cfam_323, retro_cfam_490, retro_cfam_629,
|
| Cavia porcellus | ENSCPOG00000011651 | 11 retrocopies | |
| Equus caballus | ENSECAG00000009065 | 7 retrocopies |
retro_ecab_1025, retro_ecab_1105, retro_ecab_509 , retro_ecab_632, retro_ecab_876, retro_ecab_892, retro_ecab_949,
|
| Monodelphis domestica | ENSMODG00000016077 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044533 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000016704 | 8 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014179 | 12 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000015213 | 5 retrocopies |