RetrogeneDB ID: | retro_dord_354 | ||
Retrocopy location | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | scaffold_13479:11193..11373(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDORG00000008443 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.33 % |
| Parental protein coverage: | 50.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RREIKKEIQKWARGYERIFQLLEQIEGPLEVKKEIVEYAIKKAIRFNCRDLVKNLEKTLK |
| .RE..KEIQK...GYE.IF.LLE...G.LE.KKE.VEYAI....RF..R.L.K..E.TLK | |
| Retrocopy | KRELRKEIQKLGQGYEKIFELLEEMQGTLELKKELVEYAINEMKRFKSRELIKHFEHTLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000014436 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000004135 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000008443 | 1 retrocopy |
retro_dord_354 ,
|
| Homo sapiens | ENSG00000242284 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021984 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002303 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020755 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000041730 | 1 retrocopy |