RetrogeneDB ID: | retro_dord_203 | ||
Retrocopy location | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | GeneScaffold_5355:25198..25402(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDORG00000002226 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.53 % |
| Parental protein coverage: | 53.68 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | QHAVGIVVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREA |
| ....G.VV.KQVK.KI.AK..N...E.IKHSK..D.FLK..K.NDQKKK..KEK...V.LK.QPA.PR.. | |
| Retrocopy | EDSTGVVV-KQVKDKIFAKETN---ESIKHSKNQDGFLKLKKKNDQKKK-VKEK*I*VLLKHQPALPRDT |
| Parental | HFV |
| H.V | |
| Retrocopy | HCV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |