RetrogeneDB ID: | retro_cpor_1091 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_45:4932177..4932339(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ELOF1 | ||
| Ensembl ID: | ENSCPOG00000020359 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 50.91 % |
| Parental protein coverage: | 66.27 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | FCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAAN |
| FC....S..VKM..A.NT.V.S...CL..FQ...TYLSE.V..Y..WI.A.E.AN | |
| Retrocopy | FCS-TTSLAVKMNHACNTEVMSYALCLQKFQISMTYLSETVYLYIRWIVAYEVAN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 12 .54 RPM |
| SRP017611_kidney | 0 .00 RPM | 13 .50 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .97 RPM |
| SRP040447_lung | 0 .00 RPM | 9 .51 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 6 .63 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000064 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000020359 | 1 retrocopy |
retro_cpor_1091 ,
|
| Felis catus | ENSFCAG00000004926 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000001534 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000012101 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000026211 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003687 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000004812 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001807 | 1 retrocopy |