RetrogeneDB ID: | retro_cjac_537 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 1:68455171..68455525(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FKBP1A | ||
| Ensembl ID: | ENSCJAG00000020908 | ||
| Aliases: | None | ||
| Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:F6SFB9] |
| Percent Identity: | 76.27 % |
| Parental protein coverage: | 81.38 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | LPARPASAAAMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW |
| LPA.PASAA..GVQVETIS..D...FPK.GQTC.VHY..ML.DG.KFDS.RDR.K..KFMLGKQEVI.G. | |
| Retrocopy | LPACPASAATKGVQVETISL*DRCIFPKCGQTCMVHYARMLKDGRKFDSFRDRKKSLKFMLGKQEVI*GL |
| Parental | EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
| E..VAQMSVGQRAKLTISPDY.YGATGHP..IPP.ATL.FDVE.LKLE | |
| Retrocopy | EKRVAQMSVGQRAKLTISPDYVYGATGHPAMIPPYATLIFDVEPLKLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 10 .89 RPM |
| SRP051959_heart | 0 .00 RPM | 9 .31 RPM |
| SRP051959_kidney | 0 .00 RPM | 8 .19 RPM |
| SRP051959_liver | 0 .00 RPM | 7 .45 RPM |
| SRP051959_lung | 0 .00 RPM | 11 .13 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 6 .87 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 8 .98 RPM |
| SRP051959_spleen | 0 .00 RPM | 8 .30 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1198 |
| Pan troglodytes | retro_ptro_818 |
| Gorilla gorilla | retro_ggor_933 |
| Pongo abelii | retro_pabe_998 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007700 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018746 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020908 | 4 retrocopies | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Homo sapiens | ENSG00000088832 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009356 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000002629 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010852 | 5 retrocopies | |
| Pan troglodytes | ENSPTRG00000013163 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |