RetrogeneDB ID: | retro_cjac_4165 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | X:52907015..52907368(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000015775 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.03 % |
| Parental protein coverage: | 58.13 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKD |
| M..P.P.E.KAG.L.FAKM.GY.HW.A.IDE.PE...K.P..K...FF.....TAFL..KDLFPY..YK. | |
| Retrocopy | MEHPQPHEEKAGCLLFAKMTGYSHWLAWIDEFPERTMKSPRKKAFYFFLSAPMTAFLVSKDLFPYEDYKE |
| Parental | -KFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTA |
| ..F.KSNK.KGF.EGLW.IENNPG.KFTG.QAIQQQ.SSETE.EG...A | |
| Retrocopy | <EFRKSNK*KGFSEGLWKIENNPGIKFTGCQAIQQQ*SSETEVEGTASA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 5 .06 RPM |
| SRP051959_heart | 0 .00 RPM | 20 .70 RPM |
| SRP051959_kidney | 0 .00 RPM | 5 .13 RPM |
| SRP051959_liver | 0 .04 RPM | 1 .34 RPM |
| SRP051959_lung | 0 .00 RPM | 12 .79 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 2 .97 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 3 .14 RPM |
| SRP051959_spleen | 0 .00 RPM | 6 .74 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000018527 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006157 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000012471 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000015775 | 1 retrocopy |
retro_cjac_4165 ,
|
| Dasypus novemcinctus | ENSDNOG00000003696 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000010466 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002512 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028389 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004950 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000004599 | 1 retrocopy |