RetrogeneDB ID: | retro_cjac_2777 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 6:147982291..147982507(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POLR2I | ||
| Ensembl ID: | ENSCJAG00000009671 | ||
| Aliases: | None | ||
| Description: | polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa [Source:HGNC Symbol;Acc:9196] |
| Percent Identity: | 81.94 % |
| Parental protein coverage: | 57.6 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | YVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRW |
| YVNKIT.EVDELTQIIAD.SQDPTLP.TEDHPCQKC.HK..VFFQSH.A...D.M.LYYVCTAPHC.HRW | |
| Retrocopy | YVNKITQEVDELTQIIADMSQDPTLPQTEDHPCQKCSHKGTVFFQSHRAWVKDVMCLYYVCTAPHCSHRW |
| Parental | TE |
| TE | |
| Retrocopy | TE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 3 .15 RPM |
| SRP051959_heart | 0 .00 RPM | 5 .54 RPM |
| SRP051959_kidney | 0 .00 RPM | 6 .28 RPM |
| SRP051959_liver | 0 .00 RPM | 3 .68 RPM |
| SRP051959_lung | 0 .00 RPM | 4 .60 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 3 .33 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 7 .49 RPM |
| SRP051959_spleen | 0 .00 RPM | 2 .77 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000006601 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009671 | 1 retrocopy |
retro_cjac_2777 ,
|
| Dipodomys ordii | ENSDORG00000001852 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000014172 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000019738 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013044 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000024254 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001789 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003919 | 1 retrocopy |