RetrogeneDB ID: | retro_cjac_2373 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 4:118476835..118477239(+) | ||
| Located in intron of: | ENSCJAG00000004178 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000014776 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 52.55 % |
| Parental protein coverage: | 72.34 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MNGDGSFAKNPSDDEQISENKRKAFADIAQYFSKKDWKKLKYSEKITYVYMKRN-YEAMRTLGFQVTIPL |
| MNG...FAK.P.DD.QIS.....AF.....YFSKK.W.KLK.S.KIT..YMKRN..E.M..LG...T.P. | |
| Retrocopy | MNGNSTFAKSPRDDAQISKKRHTAFNVTVRYFSKKNWEKLKNSKKITHGYMKRN<HETMTKLGIKATLPT |
| Parental | FMRDKQAEDSQEDDSDRDSNPGNLLECHTMTFGMFQGLFPQIMPREPPEEEGNDSEAVPETSGTQND |
| FM..K.A.D.Q..DSDR....GN..E...M.FG...G.FP..MP...P.EEGN.S..VPE.S..QND | |
| Retrocopy | FMYNKWATDLQGNDSDRHHSCGNQDEHPQMAFGLL*GNFPKMMPKK-PAEEGNYSKGVPEASVSQND |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .58 RPM | 0 .00 RPM |
| SRP051959_heart | 17 .70 RPM | 0 .00 RPM |
| SRP051959_kidney | 0 .87 RPM | 0 .00 RPM |
| SRP051959_liver | 0 .22 RPM | 0 .00 RPM |
| SRP051959_lung | 1 .30 RPM | 0 .00 RPM |
| SRP051959_lymph_node | 1 .32 RPM | 0 .00 RPM |
| SRP051959_skeletal_muscle | 0 .96 RPM | 0 .00 RPM |
| SRP051959_spleen | 1 .43 RPM | 0 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3512 |
| Pan troglodytes | retro_ptro_2385 |
| Gorilla gorilla | retro_ggor_2374 |
| Pongo abelii | retro_pabe_2903 |
| Macaca mulatta | retro_mmul_1862 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000014776 | 1 retrocopy |
retro_cjac_2373 ,
|
| Homo sapiens | ENSG00000204645 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026107 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019164 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003504 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020365 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021857 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000015375 | 3 retrocopies |