RetrogeneDB ID: | retro_cjac_2153 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 3:80928888..80929207(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | WRB | ||
| Ensembl ID: | ENSCJAG00000005714 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.27 % |
| Parental protein coverage: | 60.92 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRMLQKDAEQ-ESQMRAEIQDMKQE-LSTVNMMDE |
| M....A..W.WLLVLSF.FG..VL.ILL..F.SFMSR...KDAEQ.ESQMRAEIQDMKQ...STVNM..E | |
| Retrocopy | MGRTKANSWGWLLVLSFLFGYSVLQILLSTF-SFMSRVQRKDAEQ>ESQMRAEIQDMKQK>FSTVNMVNE |
| Parental | FARYARL-ERKINKM-TDKLKTHVKARTAQLAKIKWVISV |
| FAR...L.ER..NKM.T..LKTHVKA.TAQL..IKWVI.V | |
| Retrocopy | FARSPTL>ERTMNKM>TNRLKTHVKAQTAQLGMIKWVINV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 4 .77 RPM |
| SRP051959_heart | 0 .00 RPM | 10 .91 RPM |
| SRP051959_kidney | 0 .00 RPM | 23 .78 RPM |
| SRP051959_liver | 0 .02 RPM | 16 .07 RPM |
| SRP051959_lung | 0 .00 RPM | 8 .49 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 5 .11 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 6 .75 RPM |
| SRP051959_spleen | 0 .00 RPM | 6 .20 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000005714 | 2 retrocopies |
retro_cjac_2153 , retro_cjac_3208,
|
| Dasypus novemcinctus | ENSDNOG00000024987 | 1 retrocopy | |
| Homo sapiens | ENSG00000182093 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013144 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015808 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020654 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000023147 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013146 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000026761 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000011427 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013915 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012736 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015373 | 1 retrocopy |