RetrogeneDB ID: | retro_chof_1818 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_392166:8..434(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NECAP1 | ||
| Ensembl ID: | ENSCHOG00000008087 | ||
| Aliases: | None | ||
| Description: | NECAP endocytosis associated 1 [Source:HGNC Symbol;Acc:24539] |
| Percent Identity: | 78.87 % |
| Parental protein coverage: | 51.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | NVSLQDHFKWVKQESEISKESQEMDTRPKLDLGFKEGQTIKLSIGNITTKKGGASKPRTSGAGGLSLLPP |
| .V.LQD.FKWVKQESEISKE..EMDT.PKLDLGFK.GQTIKLS.GNITTKKGGASKPRTSGAGGL.LL.P | |
| Retrocopy | DVALQDYFKWVKQESEISKECLEMDTHPKLDLGFKGGQTIKLSNGNITTKKGGASKPRTSGAGGLTLLLP |
| Parental | PPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVTTPATAPVTAGNYLCGDFTTAS |
| ..GG.VTI..PS.SVAISNHVTP.P.PKSN.G.SDADIL.DLD.PAPVTTPA.APV.AGN.L.GD..T.S | |
| Retrocopy | QLGGTVTISYPSPSVAISNHVTPAPTPKSNQGDSDADILSDLDFPAPVTTPARAPVSAGNDLYGDLSTVS |
| Parental | NS |
| .S | |
| Retrocopy | SS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016989 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000013930 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000008087 | 3 retrocopies |
retro_chof_1692, retro_chof_1818 , retro_chof_1913,
|
| Dasypus novemcinctus | ENSDNOG00000014778 | 2 retrocopies | |
| Homo sapiens | ENSG00000089818 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000010233 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002979 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016742 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001743 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000004309 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006358 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004238 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000023277 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000009236 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000010153 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000014260 | 1 retrocopy |