RetrogeneDB ID: | retro_cfam_596 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 14:19730178..19730385(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POLR2F | ||
| Ensembl ID: | ENSCAFG00000001437 | ||
| Aliases: | None | ||
| Description: | polymerase (RNA) II (DNA directed) polypeptide F [Source:HGNC Symbol;Acc:9193] |
| Percent Identity: | 65.75 % |
| Parental protein coverage: | 57.48 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | PYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELI |
| PYM..Y.....LGT.ALQIAMC.PVMVELEG..DPLLI.MK.LK..KIP..I..YLPD.SYED..VD..I | |
| Retrocopy | PYMGIY----MLGT*ALQIAMCTPVMVELEGDSDPLLITMKKLKVQKIPVTICHYLPDESYEDCRVDKVI |
| Parental | ITD |
| IT. | |
| Retrocopy | ITN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 30 .87 RPM |
| SRP017611_brain | 0 .00 RPM | 8 .81 RPM |
| SRP017611_kidney | 0 .00 RPM | 63 .53 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .64 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010331 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000004820 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000001437 | 1 retrocopy |
retro_cfam_596 ,
|
| Myotis lucifugus | ENSMLUG00000014315 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019063 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000012997 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000025463 | 1 retrocopy |