RetrogeneDB ID: | retro_ttru_1270 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_109204:128164..128402(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX19 | ||
| Ensembl ID: | ENSTTRG00000011489 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase assembly homolog 19 (S. cerevisiae) [Source:HGNC Symbol;Acc:28074] |
| Percent Identity: | 66.25 % |
| Parental protein coverage: | 86.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | STAMNFGSKSFQ-PRP-PDKGSFPLDHFGECKSFKERFMKCLRDNNFENALCRNESKEYLECRMERQLMV |
| S.AM.F.SK.FQ.P.P.PDKG...LDHFGECKSFKE.FMKCL..N.F.N.L.......YLECRMERQLM. | |
| Retrocopy | SMAMIFRSKCFQ>PGPAPDKGGCLLDHFGECKSFKENFMKCLQGNSFDNTLQK*IKTMYLECRMERQLML |
| Parental | PEPLEKLGFG |
| ..PLEKL.FG | |
| Retrocopy | QKPLEKLEFG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015253 | 1 retrocopy | |
| Homo sapiens | ENSG00000240230 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000034907 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007202 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000041621 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000002192 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000011489 | 2 retrocopies |
retro_ttru_1140, retro_ttru_1270 ,
|