RetrogeneDB ID: | retro_tbel_1979 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_61:145405..145630(+) | ||
| Located in intron of: | ENSTBEG00000005670 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CMC2 | ||
| Ensembl ID: | ENSTBEG00000000038 | ||
| Aliases: | None | ||
| Description: | COX assembly mitochondrial protein 2 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:24447] |
| Percent Identity: | 73.33 % |
| Parental protein coverage: | 91.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | HLHTEECNILINLLKECHKNHNILKFFGHCNDLDREMRKCLKNEYIVK---RTKSREHGDAMRKKLFSPP |
| HLHTEECNI.INLLKEC.KNHNILK.FGHCN..D.EM.KCLKNEY.VK...RTKS.EH..A.RKK.F..P | |
| Retrocopy | HLHTEECNISINLLKECYKNHNILKAFGHCNHIDWEMQKCLKNEYMVKMVKRTKSTEHCNAVRKKSFNIP |
| Parental | EESEK |
| .ES.K | |
| Retrocopy | GESGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013929 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000017009 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010422 | 3 retrocopies | |
| Felis catus | ENSFCAG00000004977 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000004378 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000011915 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000025763 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000008906 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000001006 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000038 | 3 retrocopies |
retro_tbel_1840, retro_tbel_1979 , retro_tbel_2249,
|