RetrogeneDB ID: | retro_btau_109 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 7:81396270..81396510(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSBTAG00000030274 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CMC2 | ||
| Ensembl ID: | ENSBTAG00000017009 | ||
| Aliases: | CMC2, C18H16orf61 | ||
| Description: | COX assembly mitochondrial protein 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q2NKR3] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MHPDLSPHLHTEECNVLINLLKECHKNHSILKFFGHCNDLDREMRKCLKNEYMEKRNKSRELGNAMRKRL |
| MHPDLSPHLHTEECNVLINLLKECHKNHSILKFFGHCNDLDREMRKCLKNEYMEKRNKSRELGNAMRKRL | |
| Retrocopy | MHPDLSPHLHTEECNVLINLLKECHKNHSILKFFGHCNDLDREMRKCLKNEYMEKRNKSRELGNAMRKRL |
| Parental | FNPPEESEN |
| FNPPEESEN | |
| Retrocopy | FNPPEESEN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .14 RPM | 17 .59 RPM |
| ERP005899_muscle | 0 .00 RPM | 31 .99 RPM |
| SRP017611_brain | 0 .32 RPM | 10 .78 RPM |
| SRP017611_kidney | 0 .12 RPM | 14 .46 RPM |
| SRP017611_liver | 0 .15 RPM | 11 .63 RPM |
| SRP030211_testis | 0 .15 RPM | 24 .61 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013929 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000017009 | 1 retrocopy |
retro_btau_109 ,
|
| Echinops telfairi | ENSETEG00000010422 | 3 retrocopies | |
| Felis catus | ENSFCAG00000004977 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000004378 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000011915 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000025763 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000008906 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000001006 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000038 | 3 retrocopies |