RetrogeneDB ID: | retro_sscr_763 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 4:113496440..113496747(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000021827 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.96 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MEKSPCIPEIDDSEFCVRVPGGGITKTLYDEGCSKGIPMAVLLKFVSEGDNIPDALGLVEYLNEWLQIIK |
| MEKS.C..EIDD.EF.V.V.GG.I.K.LYDEGC.K..PMA.L.KFVSEGDNI.DAL.L.EYL...LQI.K | |
| Retrocopy | MEKSLCLLEIDDPEFHVHVSGGSIKKMLYDEGCPKVFPMAALSKFVSEGDNILDALRLIEYLDVCLQIVK |
| Parental | -PCCEDTTESALPWKMPSSWRLLFGSGLPPALF |
| .P.C.D.T.SAL.WKMPSSWRLLFG.GL....F | |
| Retrocopy | >PSCDDPTASALQWKMPSSWRLLFGRGLTNVIF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 2 .65 RPM |
| SRP014902_testis | 0 .00 RPM | 3 .39 RPM |
| SRP018288_heart | 0 .00 RPM | 10 .56 RPM |
| SRP018288_kidney | 0 .00 RPM | 15 .47 RPM |
| SRP018288_liver | 0 .00 RPM | 9 .27 RPM |
| SRP018288_lung | 0 .00 RPM | 8 .15 RPM |
| SRP018856_adipose | 0 .00 RPM | 7 .80 RPM |
| SRP035408_brain | 0 .00 RPM | 11 .56 RPM |
| SRP035408_liver | 0 .00 RPM | 13 .15 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000018855 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000010042 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000017744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021855 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009063 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005086 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021827 | 2 retrocopies |
retro_sscr_1008, retro_sscr_763 ,
|