RetrogeneDB ID: | retro_sscr_365 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 13:26426076..26426389(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TAX1BP3 | ||
| Ensembl ID: | ENSSSCG00000017866 | ||
| Aliases: | None | ||
| Description: | Tax1 (human T-cell leukemia virus type I) binding protein 3 [Source:HGNC Symbol;Acc:30684] |
| Percent Identity: | 70.75 % |
| Parental protein coverage: | 84.68 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | KLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIY-VTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMV |
| .L.QGENLILGF.IGG.ID.DPS.NPFS.D...KGIY.VT..SEGGP.E.A.LQ.GDKIMQ.N.W.MTM. | |
| Retrocopy | ELCQGENLILGFRIGGRID*DPSPNPFS-D*AGKGIY>VTHISEGGPVEMAELQTGDKIMQMNSWAMTMI |
| Parental | THDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
| T..Q..K.L.K.SEEV.RLLV.RQSLQK.VQQSMLS | |
| Retrocopy | TRNQRWKQLIKYSEEVSRLLVMRQSLQKVVQQSMLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 99 .15 RPM |
| SRP014902_testis | 0 .00 RPM | 42 .72 RPM |
| SRP018288_heart | 0 .00 RPM | 37 .80 RPM |
| SRP018288_kidney | 0 .00 RPM | 46 .99 RPM |
| SRP018288_liver | 0 .00 RPM | 8 .16 RPM |
| SRP018288_lung | 0 .00 RPM | 100 .50 RPM |
| SRP018856_adipose | 0 .00 RPM | 38 .48 RPM |
| SRP035408_brain | 0 .00 RPM | 4 .48 RPM |
| SRP035408_liver | 0 .00 RPM | 8 .45 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000023829 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000013801 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000026421 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000040158 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023903 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017866 | 1 retrocopy |
retro_sscr_365 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000022920 | 1 retrocopy |