RetrogeneDB ID: | retro_sscr_1087 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | GL893245.2:64218..64567(+) | ||
| Located in intron of: | ENSSSCG00000028318 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPP1R14B | ||
| Ensembl ID: | ENSSSCG00000013035 | ||
| Aliases: | PHI-1, PPP1R14B, pPHI-1 | ||
| Description: | Sus scrofa ubiquitous PKC-potentiated PP1 inhibitor (PHI-1), mRNA. [Source:RefSeq mRNA;Acc:NM_214115] |
| Percent Identity: | 65.83 % |
| Parental protein coverage: | 80.27 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | PRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQL-TRLYDCQEEEIPELE |
| PR.....P.G...E..G..DDE.PVR.Q.KVTVK.D..E..K.L.LEEW.LEQL.T..YDCQEEE.PELE | |
| Retrocopy | PRHLLSDPLGLQAE-LGDTDDESPVRCQRKVTVK*DHQEP*KGLSLEEWVLEQL<TFPYDCQEEEKPELE |
| Parental | IDVDELLDMESDDTRAARVKELLVDCYKPTEAFISGLLDKIR-GMQKLST |
| ..V.ELLDM.S.DT.AARVK.LLVDCYKPT.A..SGLLDKI..GMQ.LST | |
| Retrocopy | TAVAELLDMKSSDTQAARVKDLLVDCYKPTDALTSGLLDKIQ<GMQ*LST |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 95 .30 RPM |
| SRP014902_testis | 0 .28 RPM | 47 .24 RPM |
| SRP018288_heart | 0 .03 RPM | 11 .89 RPM |
| SRP018288_kidney | 0 .00 RPM | 19 .70 RPM |
| SRP018288_liver | 0 .00 RPM | 18 .87 RPM |
| SRP018288_lung | 0 .00 RPM | 20 .67 RPM |
| SRP018856_adipose | 0 .00 RPM | 85 .25 RPM |
| SRP035408_brain | 0 .00 RPM | 20 .90 RPM |
| SRP035408_liver | 0 .00 RPM | 17 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000018111 | 3 retrocopies | |
| Homo sapiens | ENSG00000173457 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000013208 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004890 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000041138 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000013035 | 2 retrocopies |
retro_sscr_1087 , retro_sscr_892,
|
| Ictidomys tridecemlineatus | ENSSTOG00000021959 | 1 retrocopy |