RetrogeneDB ID: | retro_ptro_481 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 10:38637840..38638125(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FXYD6 | ||
| Ensembl ID: | ENSPTRG00000004329 | ||
| Aliases: | None | ||
| Description: | FXYD domain-containing ion transport regulator 6 precursor [Source:RefSeq peptide;Acc:NP_001230843] |
| Percent Identity: | 75.79 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MELVLVFLCSLLAPTVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR |
| ME.VL.FLCSLLA..V..SAAE.EKE.D.FHYD.QTLRI.GLV.AVVLFSVGI.LIL..RCK.SFNQKP. | |
| Retrocopy | MEVVLIFLCSLLALIVMPSAAE*EKEIDHFHYD*QTLRIQGLVCAVVLFSVGIFLILGCRCKWSFNQKPG |
| Parental | APGDEEAQVENLITANATEPQKAEN |
| .PG.EEAQVENLITANA...QKAE. | |
| Retrocopy | TPGEEEAQVENLITANAAKLQKAES |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 467 .79 RPM |
| SRP007412_cerebellum | 0 .07 RPM | 344 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 32 .18 RPM |
| SRP007412_kidney | 0 .00 RPM | 96 .97 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .06 RPM |
| SRP007412_testis | 0 .00 RPM | 43 .10 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_662 |
| Pongo abelii | retro_pabe_583 |
| Pongo abelii | retro_pabe_648 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000013044 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011989 | 1 retrocopy | |
| Homo sapiens | ENSG00000137726 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006473 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000007617 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000007348 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000003918 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000004329 | 3 retrocopies |
retro_ptro_3127, retro_ptro_421, retro_ptro_481 ,
|