RetrogeneDB ID: | retro_pabe_651 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 10_random:38582601..38582793(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SS18L2 | ||
| Ensembl ID: | ENSPPYG00000013979 | ||
| Aliases: | None | ||
| Description: | synovial sarcoma translocation gene on chromosome 18-like 2 [Source:HGNC Symbol;Acc:15593] |
| Percent Identity: | 87.5 % |
| Parental protein coverage: | 83.12 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | DWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPTS |
| DWLRGK..VN.ETIQRLLEENDQLIRCIVEYQNK.R.N.CVQ.Q.VLHRNLIYLATIADASPTS | |
| Retrocopy | DWLRGKVKVN*ETIQRLLEENDQLIRCIVEYQNKSRANDCVQCQLVLHRNLIYLATIADASPTS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 12 .66 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 15 .93 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .41 RPM |
| SRP007412_kidney | 0 .00 RPM | 8 .82 RPM |
| SRP007412_liver | 0 .00 RPM | 13 .46 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000000989 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000015005 | 4 retrocopies | |
| Homo sapiens | ENSG00000008324 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000021542 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013024 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000031677 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005848 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015198 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000013979 | 2 retrocopies |
retro_pabe_513, retro_pabe_651 ,
|