RetrogeneDB ID: | retro_pabe_2783 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5:135159797..135160234(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC24 | ||
| Ensembl ID: | ENSPPYG00000003390 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 24 [Source:HGNC Symbol;Acc:26979] |
| Percent Identity: | 68.67 % |
| Parental protein coverage: | 99.33 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MMAVEQMPKKDWYSIL-GADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAW-KI |
| .MA.E.MPK..WYSIL.GAD...N.S.LKQKY.K.IL.YH.D.QSTDVPAG.VE.C.QKFIEIDQAW.K. | |
| Retrocopy | IMAFEMMPKNNWYSIL>GAD--RNVSNLKQKYKKFILKYHSD*QSTDVPAGIVEDCIQKFIEIDQAW>KF |
| Parental | LGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDT |
| .G....K.EYD.Q..EDDLRN..PVDAQ.YLE..SW...D.SF..SC.CG.K.SVSKDEAEEV.L.SCDT | |
| Retrocopy | QGMKR-KKEYDPQWHEDDLRNMEPVDAQLYLEKVSWKKDDDSFSPSCQCGRKHSVSKDEAEEVNLFSCDT |
| Parental | CSLIIELLHY |
| CSLI.ELLHY | |
| Retrocopy | CSLITELLHY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .40 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .90 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .49 RPM |
| SRP007412_kidney | 0 .00 RPM | 3 .94 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .53 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_2301 |
| Macaca mulatta | retro_mmul_2112 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000013512 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000000248 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000003054 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000007553 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000006845 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017878 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007848 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001638 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003390 | 2 retrocopies |
retro_pabe_2783 , retro_pabe_2788,
|
| Pan troglodytes | ENSPTRG00000003471 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009243 | 1 retrocopy |