RetrogeneDB ID: | retro_pabe_2122 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 2b:63686845..63687057(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LY6E | ||
| Ensembl ID: | ENSPPYG00000018927 | ||
| Aliases: | None | ||
| Description: | lymphocyte antigen 6 complex, locus E [Source:HGNC Symbol;Acc:6727] |
| Percent Identity: | 57.53 % |
| Parental protein coverage: | 54.96 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MKIFLPVLLAALLGVER-ASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSK |
| MK.FLP.LLAA.LGV.R.A..L....C.NQ.SNL.CLKPTICS..D...V..SA..GIG.....GH.L.K | |
| Retrocopy | MKVFLPALLAAFLGVGR<ARLLVHCCCTNQNSNLCCLKPTICSHEDRPYVNMSA-VGIGSVMDIGHILNK |
| Parental | TCS |
| .CS | |
| Retrocopy | GCS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 15 .32 RPM |
| SRP007412_heart | 0 .00 RPM | 7 .22 RPM |
| SRP007412_kidney | 0 .00 RPM | 10 .74 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .80 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000021460 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000022587 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018927 | 1 retrocopy |
retro_pabe_2122 ,
|
| Tursiops truncatus | ENSTTRG00000001986 | 2 retrocopies |