RetrogeneDB ID: | retro_pabe_1886 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 22:36036547..36036815(+) | ||
| Located in intron of: | ENSPPYG00000011856 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | JTB | ||
| Ensembl ID: | ENSPPYG00000000791 | ||
| Aliases: | None | ||
| Description: | jumping translocation breakpoint [Source:HGNC Symbol;Acc:6201] |
| Percent Identity: | 63.44 % |
| Parental protein coverage: | 62.33 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | VVAEECSPCSNFRAKTTPECGSTGYVEKITCSSSKR-NEFKSCRSALMEQRLFWKFEGAVVCVALIFACL |
| ...EE....S.F.AK.TPECG.TG.VEK...SSSK.....K..RSALME..LFWKFEGA.V.VALIFACL | |
| Retrocopy | ICIEEGTAHSHFQAKVTPECGFTGCVEKTASSSSKE<MSLKASRSALMEIHLFWKFEGA-VDVALIFACL |
| Parental | VIIRQRQLDR-KALEKVRKQIES |
| VI..Q.QL...KALEKV..QIES | |
| Retrocopy | VISCQQQLGK<KALEKVWRQIES |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 22 .06 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 32 .22 RPM |
| SRP007412_heart | 0 .00 RPM | 12 .49 RPM |
| SRP007412_kidney | 0 .03 RPM | 37 .69 RPM |
| SRP007412_liver | 0 .06 RPM | 41 .92 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Callithrix jacchus | retro_cjac_496 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000002520 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009973 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000740 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008256 | 1 retrocopy | |
| Felis catus | ENSFCAG00000012590 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013299 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011788 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000003210 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000791 | 1 retrocopy |
retro_pabe_1886 ,
|
| Sus scrofa | ENSSSCG00000006559 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012646 | 1 retrocopy |