RetrogeneDB ID: | retro_pabe_1828 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 20:45503515..45503810(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRM | ||
| Ensembl ID: | ENSPPYG00000001892 | ||
| Aliases: | None | ||
| Description: | spermidine synthase [Source:HGNC Symbol;Acc:11296] |
| Percent Identity: | 77.45 % |
| Parental protein coverage: | 56.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | DVIQVSKKFLPGMAIGYSSSKLTLHVGD-GFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT- |
| DVIQVS.KFLPGMA..YSSSKLTLHV.D..FEFMKQN.D.FDV.ITD..D.MGPAESLFKE.Y.Q.MK.. | |
| Retrocopy | DVIQVSRKFLPGMASCYSSSKLTLHVDD<RFEFMKQN*DVFDV-ITDFPDHMGPAESLFKEAYCQRMKVK |
| Parental | -ALKEDGVLCCQGECQWLHLDLI-KEMRQFCQ |
| .AL.EDG.LCCQGE.QWLHL.LI.KEMRQFCQ | |
| Retrocopy | MALEEDGILCCQGERQWLHLHLI<KEMRQFCQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 38 .26 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .69 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .41 RPM |
| SRP007412_kidney | 0 .03 RPM | 16 .18 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .42 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002354 | 4 retrocopies | |
| Homo sapiens | ENSG00000116649 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000014385 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007002 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000019321 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009532 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000001892 | 3 retrocopies |
retro_pabe_1181, retro_pabe_1828 , retro_pabe_2044,
|
| Pan troglodytes | ENSPTRG00000000138 | 3 retrocopies |